A cutaway of a pump

cutaway-pump · science · SVG, currentColor

A centrifugal pump sliced open to reveal the impeller and housing inside. Suited to engineering, industrial, and how-it-works content explaining fluid-moving machinery.

Draw with this icon Download SVG

Tags

pumpcutawayimpellercentrifugal pumpcross-sectiondiagramexploded viewmachinerymechanicalengineeringfluidindustrypump cross-sectionpump diagram

Free for commercial use, no attribution — license. Or use it on an infinite canvas.

More science

An antibody
An antibody
An asteroid
An asteroid
An astrolabe
An astrolabe
Atom
Atom
A barometer
A barometer
A battery
A battery
A beaker
A beaker
A brain
A brain
A burette
A burette
A caldera
A caldera
A centrifuge
A centrifuge
A chromosome
A chromosome

All science icons →